PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g23341.1.p
Common NameBRADI_2g23341
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 555aa    MW: 60964.4 Da    PI: 8.1721
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g23341.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.7e-1761107148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg WT+eEd +l +av  + g +Wk+Ia+ ++  Rt+ qc +rwqk+l
  Bradi2g23341.1.p  61 RGGWTPEEDAKLRKAVSAFEGQNWKKIAESFP-DRTEAQCLHRWQKVL 107
                       789*****************************.************986 PP

2Myb_DNA-binding62.87e-20113157146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g+WT+eEde ++d vk++G++ W+ Ia+ +  gRt+kqc++rw++
  Bradi2g23341.1.p 113 KGPWTKEEDETIIDMVKEHGPRKWSDIAKSLR-GRTGKQCRERWHN 157
                       79******************************.***********98 PP

3Myb_DNA-binding57.72.8e-18165208146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g WT eE+ llv+a+++lG++ W+ Ia+ ++ gRt++ +k++w++
  Bradi2g23341.1.p 165 KGFWTVEEERLLVNAHRMLGNK-WADIAKLLP-GRTDNAVKNHWNS 208
                       688*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3256107IPR017930Myb domain
SMARTSM007174.7E-1460109IPR001005SANT/Myb domain
PfamPF002492.2E-1561107IPR001005SANT/Myb domain
SuperFamilySSF466896.32E-1562117IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-2263123IPR009057Homeodomain-like
CDDcd001678.79E-1364107No hitNo description
PROSITE profilePS5129431.088108163IPR017930Myb domain
SuperFamilySSF466891.11E-31110206IPR009057Homeodomain-like
SMARTSM007173.6E-18112161IPR001005SANT/Myb domain
PfamPF002493.0E-18113157IPR001005SANT/Myb domain
CDDcd001678.33E-17115159No hitNo description
Gene3DG3DSA:1.10.10.605.9E-26124166IPR009057Homeodomain-like
SMARTSM007173.1E-16164212IPR001005SANT/Myb domain
PROSITE profilePS5129423.478164214IPR017930Myb domain
PfamPF002497.9E-16166208IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-22167215IPR009057Homeodomain-like
CDDcd001671.25E-12168207No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MSAMVLVEER NGDGGTGWVL ALPASEGGSY GRRARTSKVL SSPIDSISGR RQTSGAVRRP  60
RGGWTPEEDA KLRKAVSAFE GQNWKKIAES FPDRTEAQCL HRWQKVLDPE LLKGPWTKEE  120
DETIIDMVKE HGPRKWSDIA KSLRGRTGKQ CRERWHNSLN PQLRKGFWTV EEERLLVNAH  180
RMLGNKWADI AKLLPGRTDN AVKNHWNSSM RKRLKHYNRS VTRNDLKHAA NRPPAENHID  240
LNKEPSISWQ DCSVGCSNFL SPSMPVARPV TLCEASVPDD SAVALALLGL KRDSGHDQDR  300
GLMFVSENGL EIDLMTDKMG PSGLAKSGET ANIGCESPSQ NEARPFGSLR YQIPMLDDTG  360
LARSPAFSTH HGVASQSLTG YTTPFPTDGK KSDLLSVDAI LKSAAENFPS TPSILRCRKR  420
KKPAPDQDCE LRIDTNGGSF DTPMGNSNAD GPNSFKNSTS LSDVLGKSDD SPSYRPRSKS  480
MAVLKTIEEH LDFSSDAMDI SDTSGLWKPA CRSSEIINSS TDISSVQDKK IGGHMIGLET  540
STDDFVHTTK LDAI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-67612149159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-67612149159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1417421RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014755208.10.0PREDICTED: LOW QUALITY PROTEIN: myb-related protein B-like
TrEMBLA0A0Q3IJE60.0A0A0Q3IJE6_BRADI; Uncharacterized protein
STRINGBRADI2G23340.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.26e-90myb domain protein 3r-5